PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 599aa    MW: 67200.9 Da    PI: 4.825
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902714.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.73.5e-922255961374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalkl....fsevsP 89 
                     lvelLl+ Ae v  +++e+a++lL++   l+s++g+p+qRl+ yf eAL++r+ r ++    k l    + +    +e+++ l+l    f    P
  XP_015902714.1 225 LVELLLASAEKVGCQQFERASKLLNQCDILSSNTGNPVQRLVYYFSEALRERIDReTGRFALKGLgDKGAFD---IDEAIMPLNLinlaFLTGIP 316
                     689****************************************************44444555553333444...55555555555559****** PP

            GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                     + ++ ++ a qaIle v++++++HiiD+ i++G+QW  L+qaL+sR+e p   l+i +vg    ++k+ +e tg+rL +fA++l++pf+f+++++
  XP_015902714.1 317 FCQLVQFSATQAILENVSEAKKIHIIDLRIKNGVQWTVLMQALTSRKECPLeLLKISAVGT---TRKNLIEDTGKRLLSFAQSLNLPFSFKTVMV 408
                     **********************************************96655499*******...57999************************** PP

            GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                     +++ dl+ + ++++ +E++aV + + l+++l ++ +les    ++k++++++P v+vv+e e +hns+ F++rf+ea+ ++ a fd+lea l r+
  XP_015902714.1 409 RDMVDLKEDLFELDADETVAVYSPYTLKSMLPQPNTLES----LMKMIRNIKPCVMVVAEIEGNHNSPAFVNRFTEAFFFFGAYFDCLEAFLKRD 499
                     *******************************99999999....**************************************************** PP

            GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSa 372
                     + +r+  E  +lgr+i+n+va+eg++r+ rh + + Wr+ + ++G+ ++++s+    qakll++  + +   +++ + ++l+ gWk+ pL+svS+
  XP_015902714.1 500 DPNRMIAESLYLGRSISNIVATEGEKRQTRHVKINVWRAFFARFGLLEAEFSTASLYQAKLLVNSSScGSSCTLDMNGKCLLVGWKGTPLLSVSV 594
                     *******************************************************************9999************************ PP

            GRAS 373 Wr 374
                     W+
  XP_015902714.1 595 WK 596
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.203199575IPR005202Transcription factor GRAS
PfamPF035141.2E-89225596IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MEDITFCFEQ FSYDGVEDKL GSTDKDFEST KKINIGKNFV LHGAEDQQVS IGNNSLCSDY  60
PFYGDGCLQE GFPFSKHQQE LQQQQQSISD CGLLDDLHFD AFSPPLQTCI EEIEKFGKFP  120
TTIPNVEAKK EKENPFPLAA LELLKNYGSG FKRLNAERIV EPNNDAAACI EMENQGLSTE  180
EIVRVAGARF IQYTSQAGEV PSMPSHPFEL SLLGLSHEEI KDVELVELLL ASAEKVGCQQ  240
FERASKLLNQ CDILSSNTGN PVQRLVYYFS EALRERIDRE TGRFALKGLG DKGAFDIDEA  300
IMPLNLINLA FLTGIPFCQL VQFSATQAIL ENVSEAKKIH IIDLRIKNGV QWTVLMQALT  360
SRKECPLELL KISAVGTTRK NLIEDTGKRL LSFAQSLNLP FSFKTVMVRD MVDLKEDLFE  420
LDADETVAVY SPYTLKSMLP QPNTLESLMK MIRNIKPCVM VVAEIEGNHN SPAFVNRFTE  480
AFFFFGAYFD CLEAFLKRDD PNRMIAESLY LGRSISNIVA TEGEKRQTRH VKINVWRAFF  540
ARFGLLEAEF STASLYQAKL LVNSSSCGSS CTLDMNGKCL LVGWKGTPLL SVSVWKFLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3824459622375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902714.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5XKD70.0M5XKD7_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-54RGA-like 1